PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10017047m
Common NameEUTSA_v10017047mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 283aa    MW: 32376.6 Da    PI: 8.7804
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10017047mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.36.3e-312473150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  Thhalv10017047m 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73
                     79***********************************************8 PP

2K-box78.51.7e-2695160772
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 
                       s++ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL+lkeL++Le++Lek+++++RskK ++
  Thhalv10017047m  95 PSVTEANTQYYQQESSKLRRQIRDIQNLNRHILGESLGSLNLKELKNLESRLEKGISRVRSKKVNH 160
                      45899**********************************************************775 PP

3K-box22.35.3e-0919322469100
            K-box  69 KnellleqieelqkkekelqeenkaLrkklee 100
                      ++e+l+++ie++qk+e elq++n++Lr+k+ e
  Thhalv10017047m 193 QHEMLVAEIEYMQKREIELQNDNMYLRSKITE 224
                      689**************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.1E-401675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.3891676IPR002100Transcription factor, MADS-box
CDDcd002651.05E-431790No hitNo description
SuperFamilySSF554552.62E-321788IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-321838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003194.1E-262572IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-325374IPR002100Transcription factor, MADS-box
PfamPF014865.5E-21100222IPR002487Transcription factor, K-box
PROSITE profilePS5129711.503102228IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MEGGASNEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPSVTEA NTQYYQQESS KLRRQIRDIQ  120
NLNRHILGES LGSLNLKELK NLESRLEKGI SRVRSKKVNH YSFIDQTSMF GYIVFTTLSD  180
YSCPLHLIFV FPQHEMLVAE IEYMQKREIE LQNDNMYLRS KITERVGLQQ QESSVIHQGT  240
VYESGVSSSH QSDQYNRSYI PVNLLEPNQN PSDQDQPPLQ LV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-191784168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-191784168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-191784168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-191784168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-191684169Myocyte-specific enhancer factor 2B
1tqe_Q1e-191684169Myocyte-specific enhancer factor 2B
1tqe_R1e-191684169Myocyte-specific enhancer factor 2B
1tqe_S1e-191684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU4243430.0EU424343.1 Brassica napus shatterproof 2 (SHP2) mRNA, SHP2-b allele, complete cds.
GenBankJQ9730830.0JQ973083.1 Brassica napus Shatterproof (SHP2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411553.10.0hypothetical protein EUTSA_v10017047mg
SwissprotP293851e-167AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLV4P1520.0V4P152_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_40020191e-164(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33412350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.11e-143MIKC_MADS family protein